PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.A01055.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family Trihelix
Protein Properties Length: 576aa    MW: 63990.8 Da    PI: 8.5634
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.A01055.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix97.61.1e-3079163187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW++qe+laL+++r+em+  +r++ lk+plWe+vs+k++e g++r++k+Ckek+en++k+yk++ke++++r++++s  +++fdqlea
  Migut.A01055.2.p  79 RWPRQETLALLQIRSEMDAVFRDATLKGPLWEQVSRKLAELGYQRNAKKCKEKFENVQKYYKRTKETRGGRHDGKS--YKFFDQLEA 163
                       8*********************************************************************966666..*******85 PP

2trihelix103.31.8e-32416501186
          trihelix   1 rWtkqevlaLiearremeerlrr.gklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                       rW+k evlaLi++r+ +e+r+++ g  k+plWee+s++m+  g++r++k+Ckekwen+nk++kk+ke++kkr +e+++tcpyf++l+
  Migut.A01055.2.p 416 RWPKAEVLALIQLRSGLEHRYQEtGLPKGPLWEEISARMKGIGYNRNAKRCKEKWENINKYFKKVKESDKKR-PEDTKTCPYFHELD 501
                       8*********************846789*******************************************8.9999********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.176138IPR001005SANT/Myb domain
PROSITE profilePS500906.55178136IPR017877Myb-like domain
CDDcd122039.57E-2678143No hitNo description
PfamPF138372.0E-2178164No hitNo description
SMARTSM007170.0014413476IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-4415473IPR009057Homeodomain-like
PfamPF138377.1E-23415503No hitNo description
PROSITE profilePS500907.015415474IPR017877Myb-like domain
CDDcd122031.01E-26415481No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MQHQQQGGGG GGGTAAGGGG GGGAGEMNFG TDEHQKLGDL GIAEAASPIS SRPPAANNNF  60
EEMMRVTAAE GGGGGSGNRW PRQETLALLQ IRSEMDAVFR DATLKGPLWE QVSRKLAELG  120
YQRNAKKCKE KFENVQKYYK RTKETRGGRH DGKSYKFFDQ LEALNTSAPS TTTTSENLVH  180
HHHHHILPIT TSLPPVLREP PSAPPPPPPP LFSTVGVSFS SSSDEEQEDD EEMEAELGDD  240
INLMMRRKRK RRSGGNSRSS SSEERMMEFL EGVVKQVMQK QESMQQKFLH AIEKREHDRM  300
IREEAWKRQD MARLARQQDL MAQERSISAS RDAAIVAFLE KITGQKVNLP HHNPTPPPPP  360
PPTTNNYSMQ QLMIPTDKIT ENSSREMVVA VVPPEKQIQQ QHDQLITTGG TGSSSRWPKA  420
EVLALIQLRS GLEHRYQETG LPKGPLWEEI SARMKGIGYN RNAKRCKEKW ENINKYFKKV  480
KESDKKRPED TKTCPYFHEL DELYRKKVLG NTSGTTTTTT ILGGAAAFPE QERHQQDVVG  540
MMSSEDNKNE LQASSTLFGE QSQANIGGGV KQKPC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1245250RRKRKR
2245251RRKRKRR
3246251RKRKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012858956.10.0PREDICTED: trihelix transcription factor GTL1-like isoform X2
TrEMBLB9RYZ91e-160B9RYZ9_RICCO; Transcription factor, putative
STRINGGSMUA_Achr11P03520_0011e-145(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.17e-69Trihelix family protein